SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937566|ref|YP_001435362.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937566|ref|YP_001435362.1|
Domain Number 1 Region: 3-252
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.02e-89
Family Histidine biosynthesis enzymes 0.0000000859
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937566|ref|YP_001435362.1|
Sequence length 255
Comment imidazole glycerol phosphate synthase subunit hisF [Ignicoccus hospitalis KIN4/I]
Sequence
MPLTKRIIPCLDVKDGRVVKGVSFQNLRDAGDPVELAAYYQEQGADEIVFLDISATPEGR
ETMIEVVRRTAENLSIPLTVGGGVRSLEHIEKLLKAGADKVSINTAAVKNPLLITAAAEE
FGSQAVVVAIDAKRKGNGWEVYVSAGKVPTGLDAVEWAKKAEELGAGEILLTSIDYDGTQ
NGYDLELTRAVSEAVKIPVIASGGAGELEHFYAVLTEGKADAALAASVFHYGKFTVGDVK
KYLIQRGVPVRPCCW
Download sequence
Identical sequences A8AAK3
453591.Igni_0773 WP_012122919.1.33635 gi|156937566|ref|YP_001435362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]