SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937598|ref|YP_001435394.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937598|ref|YP_001435394.1|
Domain Number 1 Region: 82-172
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.04e-29
Family Imidazole glycerol phosphate dehydratase 0.00036
Further Details:      
 
Domain Number 2 Region: 1-75
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.39e-16
Family Imidazole glycerol phosphate dehydratase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937598|ref|YP_001435394.1|
Sequence length 189
Comment imidazoleglycerol-phosphate dehydratase [Ignicoccus hospitalis KIN4/I]
Sequence
MERRTKETVVKVEKCERASADVEIPFFRHMLETFLKHSGLAACISARDLQGFDDHHLVED
VAIVLGRFLKEEFAKKVEEGTLKRFTWSLVPMDEALARCALDVSGRGGFYGSMEFEREEI
GGLALENVEHFFETLAREARITLHLDLLKGKNDHHKVEALFKAFAKCVSEALGYGGELST
KGVIEINGQ
Download sequence
Identical sequences A8AAN5
WP_012122951.1.33635 453591.Igni_0805 gi|156937598|ref|YP_001435394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]