SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937632|ref|YP_001435428.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937632|ref|YP_001435428.1|
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000889
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.016
Further Details:      
 
Weak hits

Sequence:  gi|156937632|ref|YP_001435428.1|
Domain Number - Region: 190-234
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00136
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156937632|ref|YP_001435428.1|
Sequence length 320
Comment AsnC family transcriptional regulator [Ignicoccus hospitalis KIN4/I]
Sequence
MLSELDKRLLYELQYNFPLTPTPFEEVARALGISQERVLERTKELMDNKIIKRIGFTVNY
KSMGKVAALVGVKVRGRKDVEALKAILMNNPEVTHNYLRDDPDYQVWFTIKAKNMEVLKE
EVKNILEPLGLNDYVVLPSKKVCKVSVRYDPIRGIAWSPYSPQKDEVPKPEDLGLPEEFP
KDVSRLKPVERPYAEVAKKYGMSEEEVVEKVKLLLREGVLRNPGASVDGDKIGFKYNSMI
VMKVDDDVEVCRRIAEEVPEASHVVARVVDERWPYPVYFVLHATKKELVEDVASRVIEKF
DPYDYRKLYSLENLKPGVAR
Download sequence
Identical sequences A8AAR9
gi|156937632|ref|YP_001435428.1| 453591.Igni_0839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]