SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937669|ref|YP_001435465.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937669|ref|YP_001435465.1|
Domain Number 1 Region: 316-438
Classification Level Classification E-value
Superfamily vWA-like 0.000000000983
Family Integrin A (or I) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937669|ref|YP_001435465.1|
Sequence length 455
Comment von Willebrand factor A [Ignicoccus hospitalis KIN4/I]
Sequence
MYASLKLREKVERAIAYLSAKNPGLGGHVAKYSVKVGAREGGYAYFDYRDGSVVVSKEWL
YKLDHKGLGELLAHEALHGVLGHWIYLKERKVSHPLLWNLACDIEVNSILEELGLFSNLY
SSMIKLTGSEPVTWRRFRFIGVGPKEPAELIYEKLLNSINNNELRLVIENQRGEREAHGR
GERSYYDFTVVVSDVVDSVSNEERRVYPKEKLWHGSKDVEEEFKKSYEYFKNTKDPTKLK
DKVVEQAVELAVSLRRAGNLPGGLERFVAPSKPQVQWALLLRSALKKGTIKSVRSWQVPN
RRGLEGVPGYLRTGNNLWLLVDTSASITDEELSTFLAEVVAISKLGKVNLVTWDVEPNLV
VTAASRSRLLNYVKKSVKGGGGTLSRPALEFVYKKMRRGDVVVVLTDGYWFDETEVTDVM
RKIKKYSSAAVLVTVGTVPEDAREAGWTVIRIKRA
Download sequence
Identical sequences A8AAV6
WP_012123022.1.33635 gi|156937669|ref|YP_001435465.1| 453591.Igni_0876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]