SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937715|ref|YP_001435511.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937715|ref|YP_001435511.1|
Domain Number 1 Region: 14-252
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.38e-68
Family Pseudouridine synthase II TruB 0.000000367
Further Details:      
 
Domain Number 2 Region: 253-335
Classification Level Classification E-value
Superfamily PUA domain-like 4.42e-21
Family PUA domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156937715|ref|YP_001435511.1|
Sequence length 349
Comment rRNA pseudouridine synthase [Ignicoccus hospitalis KIN4/I]
Sequence
MKEALEWYEEMHRKCDFRGKWVIREEAETDPKYGKEPWKRDVKELVELGVVNLDKPPGPT
SHEVVAWIKRMFGLERAGHGGTLDPKVTGVLPVALAEATKVIHYVMLSGKEYVMVIQFHD
AVKEEEVIENLKYLVGEIYQRPPLRSSVKRQLRTKKVYYIHVLEFWPERRMALVRVGSES
GTYMRKLAHDLGLLVGTGAHMRELRRTRSGPFHEDWNLVRMQDLSEAKFLYDNYGDDSLL
KKYIMPCEVATCHMPKIMIKDGAVDAVAHGANVSIRGVAALTDNMKKGDVVAVVSLKGEL
VAIAQALVSSQEALKMEKGWVAKTKRVIMKPGTYPDVWRKKKASQQEGG
Download sequence
Identical sequences A8AB02
gi|156937715|ref|YP_001435511.1| 453591.Igni_0924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]