SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937719|ref|YP_001435515.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937719|ref|YP_001435515.1|
Domain Number 1 Region: 118-204,242-501
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.28e-79
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000055
Further Details:      
 
Domain Number 2 Region: 503-622
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.07e-29
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00027
Further Details:      
 
Domain Number 3 Region: 6-111
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.00000000000405
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156937719|ref|YP_001435515.1|
Sequence length 622
Comment arginyl-tRNA synthetase [Ignicoccus hospitalis KIN4/I]
Sequence
MYVLSETKSNFLKLIAEALKRRGLEVEEEELERLAGRPPSPEMGDLGVSLFRYAKKLGLR
PEELTSELKGEIEGRLAGVKEVKAIGGFLNVELEPSWLAERALREASREDYGKWSFSGRL
VVEHTSANPVHPLHVGHARNMFLGDSLVRILKNWGADVQSRFYINDMGRQVAVLVYGLLK
LGRLEPPEGEKPDHWYGKVYSVANALVELNSPSKGDDEKKEWEEVLKELESKWPEIVREM
KEKFDDEDPEAKVSELMKKYEEGDPEVKETFRKVVNEVLKGFKETMERVGVNVDKWDWES
DLVWSGEVDKIINMAKEKGLVIEKDGALVMVFKNLNDEVRRRLRIPKGLQIPPLVLKRSD
GTTLYTTRDIAYTIKKFEEFRADRVINVIAAEQRLPQIQLRLALWELGFKEYAENLIHYA
YEMVNVPGMKMSGRRGRMITLDWLLDEAERRVRELVEGRSEAEDVDEVVKKVAVGAVKFA
MVSVSPEKPITFKWEEVLNFERNSAPYLQYTYARAVGILRKGGEPDLERADYSKAEKYKD
MILSIAEFPEVARKAAEDLKPDLIATYLLSLADKFNEFYHKEPVAKEPDEGLRNLKLALV
KAVANTIRRGLWLLGVEAPARM
Download sequence
Identical sequences A8AB06
gi|156937719|ref|YP_001435515.1| 453591.Igni_0928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]