SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937729|ref|YP_001435525.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937729|ref|YP_001435525.1|
Domain Number 1 Region: 26-164,404-617
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.59e-53
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0022
Further Details:      
 
Domain Number 2 Region: 190-324
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.47e-20
Family ValRS/IleRS/LeuRS editing domain 0.002
Further Details:      
 
Domain Number 3 Region: 633-760
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00000567
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937729|ref|YP_001435525.1|
Sequence length 845
Comment leucyl-tRNA synthetase [Ignicoccus hospitalis KIN4/I]
Sequence
MQQKFFVTAAFPYALPLDVDELVTRVRSYLVADVYARYHEARGRRVLFPMAFHYSGTPLV
SFYERVKSRSPEALKLLKELGVPEDVKSPKELGDFMSRKLKELFDSLRLRIDWEHSFTTE
DPGFKSFVKWIYLKLKEKGLVVKGTYPVPWDPVEEVPVSSHDTEGFKQIKVGSFFLLMFE
LSPGLYLPAAARPETSFGITNIWINPKAEYKIVEAGGKRMIMSSKAAFKIRFQLDEVFEV
GKVDPEEILGKRAVNPITGESVPVLPSSSVDPERGSGVVASKPAHDVNDYREVQKLLSKP
FVLESFDVDPKELEPKAVIELPGCEVPAACFEDNRELVLAERSKGKLKPEAVLKALKGSE
DQFLKGLLLTVLTERPVAEVSEVIKRAATVGGVALEFYDVLNGPIRSRFGNEVVVKVLKD
QWFLNYDDEKWKKKALEVLSLMEVVPKEVSRSLVTVIESLKKRAFALARGLGTPLPWDEN
LVIDSLSDSTLYYLFYLFADVLKDKEVKPEAWDYLILGEGKAEDLKYLRKRFLEWMPLDM
RVVHEELVSNHVAYMLFHHAAIFGTSNVPRKLLVTGEVEGVSVNPFKEDPQALRLYLLTA
AKPTSPLKFSEKDLREVQKRIEEILKEWPSGDREAGELEEWLESALALRVQRAEAALEQG
DVREAALQALGFLKDLRRYYQRLEDKGLPPSKEVRRLLREWGSLLYPFAPSLAEALGGVP
RWPSLERNLEVEAKEAYFDMLLNEIKKVKSDKVLVEVAPREATEALREVVESVEEGVWEE
LEDVPRQLLERALKLSEEWRELLYYIKDEYEMASSLKEELERRTGKEVHVKVGDAQPLSP
KVRGL
Download sequence
Identical sequences A8AB16
gi|156937729|ref|YP_001435525.1| 453591.Igni_0938 WP_012123082.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]