SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937761|ref|YP_001435557.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937761|ref|YP_001435557.1|
Domain Number 1 Region: 167-375
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.74e-80
Family ATP sulfurylase catalytic domain 0.00000103
Further Details:      
 
Domain Number 2 Region: 5-159
Classification Level Classification E-value
Superfamily PUA domain-like 4.87e-47
Family ATP sulfurylase N-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937761|ref|YP_001435557.1|
Sequence length 382
Comment sulfate adenylyltransferase [Ignicoccus hospitalis KIN4/I]
Sequence
MVSKPHGGKLVERVAKGKTRERLVEEAKEMVNVQVDEGLAADVANVAHGVYSPLEGFMVR
EDYLSVLEFMRLSNDLPWTIPIILDVDENVKKSVREGDEVAIFFKGKPIAILYVEEIFPW
DKNYHTLKVFKTDDLNHPGVRKVFNKKDYLLGGPLIQISDVPEPFEKYRLWPKETRVLFE
QKGWKRVAAFQTRNVPHLGHEYVQKAALTFTDGLFVNPLVGWKKPGDFRDEVIIKAYEAL
IEHYYPKDSVAFSVLRMEMRYAGPREAVHHAIVRKNFGATHFIVGRDHAGVGNYYGPYEA
WDIFKNFPDLGITPLFVREAFYCKKCGGMVNEKICPHPEEYRIRISGTKLRKMIMEGKRP
PEYMMRPEVAEVVLSFEDPFVH
Download sequence
Identical sequences A8AB48
WP_012123114.1.33635 453591.Igni_0970 gi|156937761|ref|YP_001435557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]