SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937781|ref|YP_001435577.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937781|ref|YP_001435577.1|
Domain Number 1 Region: 1-311
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.26e-95
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000325
Further Details:      
 
Domain Number 2 Region: 340-463
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.96e-25
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156937781|ref|YP_001435577.1|
Sequence length 464
Comment cysteinyl-tRNA synthetase [Ignicoccus hospitalis KIN4/I]
Sequence
MLKVFNTLTRRLEDFKPLEPPLVRMYVCGPTVYDHSHIGHARTWVAFDIIKKYLRLKGYN
VIHVQNITDIDDKIINRARELGVSWKEVADTYTNEYFELMKKLKVFPTVHPRVTDHIDDI
IEFVQDLVDKGYAYVTQSGVYFDVDKYPYYGQLSGIKDKKMWSQEEFVKDKKNPYDFALW
KCAKPGEPWWDSPWCKGRPGWHIECSTMSSKYLGKQFDVHGGARDLIFPHHENEIAQSEA
RFGVRPWVKYWLHSGYLTVKGEKMSKSLGNIVPLKDVLKSFEPEVVRYWLSSAHYRTELD
FSWERLEEAKRSLTRMRMTVDELRKIVKKESPKGKLDEWEIKAIYEVSKIRNEFYDAMDN
DFNTPEAWAAVREALRLGNKAIEEGSWEVSLAVLEFVNEADKVFEVFEERVHEGVEPFID
LLVEVRSKLREMKQWELADYIRSKLDELGVKLLDKGKETEWRFA
Download sequence
Identical sequences A8AB68
453591.Igni_0991 WP_012123134.1.33635 gi|156937781|ref|YP_001435577.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]