SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937829|ref|YP_001435625.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937829|ref|YP_001435625.1|
Domain Number 1 Region: 81-214
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.41e-21
Family Cytidylyltransferase 0.0068
Further Details:      
 
Domain Number 2 Region: 3-73
Classification Level Classification E-value
Superfamily AF1782-like 6.54e-17
Family AF1782-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156937829|ref|YP_001435625.1|
Sequence length 226
Comment cytidyltransferase-like protein [Ignicoccus hospitalis KIN4/I]
Sequence
MSCERAAKYLNNLKGVISNIKYSPEASEVVDLAKRYVEDTEYYLNSGDCETALVTASYAE
GLLDALRMIGKAEFEWKRERRKRVFVGGTFDIVHPGHVELLKEASKLGDVIVVVARDETV
KRLKGRGPVVPQEQRRYVVGSLKYVKEAYVGGEDPIETVVKLKPDVIFLGPDQTWDEEEL
KEELRKRGLEVEVVRMKEKRCIPGGLCSSSLIIKKVLEEFCDGEGY
Download sequence
Identical sequences A8ABB6
gi|156937829|ref|YP_001435625.1| WP_012123182.1.33635 453591.Igni_1040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]