SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937836|ref|YP_001435632.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937836|ref|YP_001435632.1|
Domain Number 1 Region: 166-334
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-34
Family G proteins 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|156937836|ref|YP_001435632.1|
Domain Number - Region: 66-132
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0915
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937836|ref|YP_001435632.1|
Sequence length 341
Comment small GTP-binding protein [Ignicoccus hospitalis KIN4/I]
Sequence
MLKDPPNYFRHLHVPTADEIVKKVLKRYPELKPKSKRPKHIIELEINRVNLTYQIIIDKL
SFLDKLPKPESMHPFYLELASLTVPYQKYWAAASGLKRLREKLKEMWEDYRALVRAAVSL
EEAARFRREAVGRALSMVRRSRGALSTIREFKYAVASLPSVDFEEPRIVVAGMPSSGKSS
FVKAVSTAEVEVASYPFTTKQVHLGHFERGGRRFQVVDTPGILDRPWDSLNEIERKAVIA
IRHLPNVLLFLYDVSEEGYGVEEQTEVLDNVINVVGKEKVVVALNKIDVANERKVELAEE
EASRRGLRTFKLSLKTGEGLEELLEELVRRAEEDLSAAPKP
Download sequence
Identical sequences A8ABC3
453591.Igni_1047 WP_012123189.1.33635 gi|156937836|ref|YP_001435632.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]