SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937878|ref|YP_001435674.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937878|ref|YP_001435674.1|
Domain Number 1 Region: 334-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.44e-58
Family DNA gyrase/MutL, second domain 0.00000228
Further Details:      
 
Domain Number 2 Region: 22-251
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-32
Family DNA gyrase/MutL, N-terminal domain 0.00000155
Further Details:      
 
Domain Number 3 Region: 254-326
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.00000000000659
Family Topoisomerase VI-B subunit middle domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156937878|ref|YP_001435674.1|
Sequence length 553
Comment DNA topoisomerase VI subunit B [Ignicoccus hospitalis KIN4/I]
Sequence
MPKQRVQSERGEERFKAIGPAEFFFRNIELTGFDNYTRAIFQTVKEMLDNSLDATETHGI
LPRITIVIERLNEAKASKEEEEKKEIKGSKDGIYRITVDDNGIGVPQDKIPYAFGRMLYS
SKYVERQTRGTYGLGVKAAVLYAQKTTGEPATVISSPIKDKMTYRFKVSTNISTNEPDVK
ERGSWTKSGDWHGTRVSVIIEGNWRRARSKVVEYVRRTAIVAPYADITLITPDGTLIRYP
RRTKEMPKPPKEVKPHPLGIDIETMKRIAQLTTAKTLLQMLTTEFQAVGAKTAKAILSMA
GLEPDLEPKKLTEEQIKALVNAMKEYGTTKRYKAPSKEALSPIGEKLIKIGLKSMLNPEF
VTAVSRRPSSYSGHPFVVEVGIAYGGEIPPSDAPVLLRYANKTPLLYNERNDVSWKVVSE
LNWKNYEVSFPAPLVVLVHVASTKVPFKDVSKDTIADVPEIEAEIRLALQEAARRLKRFI
IKKRKEEELAEKVITFLKYVPEIARSLKVLSVDPETRKPTVSEEEIEEKLKKLIAKKLGV
PEDKLPEVVIGIE
Download sequence
Identical sequences A8ABG5
gi|156937878|ref|YP_001435674.1| WP_012123231.1.33635 453591.Igni_1090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]