SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937898|ref|YP_001435694.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937898|ref|YP_001435694.1|
Domain Number 1 Region: 97-410
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.32e-89
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000833
Further Details:      
 
Domain Number 2 Region: 404-554
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 0.0000000000000575
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937898|ref|YP_001435694.1|
Sequence length 562
Comment glutamyl-tRNA synthetase [Ignicoccus hospitalis KIN4/I]
Sequence
MDVRELALKHALRNAYLHGGKAQLKPVVTAVLAESPELRPKVKEIIPIIKEVVEEVNRMS
LEEQERILKERFPEALEERKKETRKGLPPLPNAERGKVKTRFAPNPDFYMTLGNARPAII
SYEYAKAYEGRFVLRFEDTDPRTKRPLPEAYEAIKEDLSWLGIGWDEEYYQSQRMEVYYG
LLRELVRRGGAYVCTCPPEEWRKLRDEGKPCPHRDLPPEEQEELLDQVLEGKFGEGEAVV
RVKTDLRHPDPSVRDWVAFRIIDTSKHPHPLTGDKYVLWPTYNFAAGVDDYLMGITHVLR
AREHRQNTVKQEFLYKHLGWTMPTVIHFGRLKLEGFVLSKSKMREAGFKGDDPRAATIRG
LRRRGFAPEAIREVMLSVGIKSSDASISFANLAAENKKVIDKKAYRVMAVEDPAPAKLLA
PEPLEAELPWHPTEGLGSRKYSVEPGEVVYLERADLRRAKRRGGLRLMELANFKYKGFDE
DEGVYLLEFESKELDKEKGYDIVQWVKDPKGAIVWRPGERKSFALVEPEALKLEGWVQLI
RKGYAKVDGVEEDTLNLIYLHE
Download sequence
Identical sequences A8ABI5
gi|156937898|ref|YP_001435694.1| WP_012123251.1.33635 453591.Igni_1110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]