SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937997|ref|YP_001435793.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|156937997|ref|YP_001435793.1|
Domain Number - Region: 154-237
Classification Level Classification E-value
Superfamily Prefoldin 0.000314
Family Prefoldin 0.017
Further Details:      
 
Domain Number - Region: 105-174
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0209
Family Occludin/ELL domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156937997|ref|YP_001435793.1|
Sequence length 294
Comment hypothetical protein Igni_1210 [Ignicoccus hospitalis KIN4/I]
Sequence
MRSNALEVKLDEINAEIEELRKERAELITKIKELRAQRKALIEKKRAEVERLRELRAERA
KLVEELRQLKESRREAKQKLNQVLEELKKLKSIVEQGKRGPSPNSLRRRIQQLEWRLQTN
VLTREEEEEIVREIARLEEALERLTKVEEAKKKLIELRAELARLRLLIKSYNENINEISN
KISEVDGRISNVREEVDRLNGKIDELKAKIDEYSKKVEEIDLKLSQLREEKRKLVEEIKK
GEAMAAKNKGEALLSELAKRAKEKMERGEPLTFEELQALMMVEGDGQENIGSNG
Download sequence
Identical sequences A8ABT4
WP_012123350.1.33635 gi|156937997|ref|YP_001435793.1| 453591.Igni_1210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]