SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156938088|ref|YP_001435884.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156938088|ref|YP_001435884.1|
Domain Number 1 Region: 6-350
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.07e-72
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156938088|ref|YP_001435884.1|
Sequence length 379
Comment tryptophanyl-tRNA synthetase [Ignicoccus hospitalis KIN4/I]
Sequence
MNGDLQKSTDYDRLIKVFGVTPLSEEVLNKLPERHKLFEIGYFFAHRDFDKVLEGWERGE
EFAILTGRGPSNVMHLGHMLLFDFVAWMQKTFKVPAYIPLSDDEKYVFLKVDSLREAAFY
AYDNALDIAALGFDEKKTYFFISTKTPEIYEMSVELSTEVTLNEVKAVFGFTDSDNPGKY
FYSVVQSAHILFPTVRKGYRSLVPIAIDQDPYIRLSRDIAERKKLPKPAALHSKYLPGLT
GEPMSASKPETAIFLDDPPKVIKEKIWKALTGGQPTVKEQREKGGDPERCVVFKWLEAFV
LDPKEAEEWKGRCRRGEVLCGECKKKLYEGIVRILKEHHERKLKLADKADKFFLHPVDWG
EVDKVKEKTKRLLEQFNLS
Download sequence
Identical sequences A8AC25
gi|156938088|ref|YP_001435884.1| 453591.Igni_1301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]