SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156938170|ref|YP_001435966.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156938170|ref|YP_001435966.1|
Domain Number 1 Region: 6-264
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.47e-68
Family G proteins 0.00000468
Further Details:      
 
Domain Number 2 Region: 471-632
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-53
Family Translational machinery components 0.000022
Further Details:      
 
Domain Number 3 Region: 262-381
Classification Level Classification E-value
Superfamily Translation proteins 9.19e-30
Family Elongation factors 0.0012
Further Details:      
 
Domain Number 4 Region: 633-726
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.21e-23
Family EF-G/eEF-2 domains III and V 0.0026
Further Details:      
 
Domain Number 5 Region: 394-469
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.4e-21
Family EF-G/eEF-2 domains III and V 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156938170|ref|YP_001435966.1|
Sequence length 740
Comment elongation factor EF-2 [Ignicoccus hospitalis KIN4/I]
Sequence
MPKYKHVEDILKIMRNVEQVRNIGIIAHVDHGKTTTSDALLAHAGILSPKLAGEARALDY
LDVEQQRGITVKAANVSLYHEYKGKPYVINLIDTPGHVDFSGKVTRSLRVLDGAILVVDA
VEGVMTQTETVLRQALEELVRPLLFINKVDRLIKELKLSPQEIQQRIVQIIKDVNERILT
FAPDPEIAKKWLLDPAKGHVALGSAKDKWGITIPMAQEKGIKFSDIVEAYAKGSKDAIEE
LFHKAPLHETLLDMVVRWVPNPREAQKYRVPRLWKGDINSELGKAMLNCDPEGPLVVFIN
DMRLDPHTKRLVATGRVWAGTATAGKEVWLVNAQKPGKILQVSIYMGPDREIVDYVTAGN
IVAMLGLDDARAGETLVDINYKDQAAPFEQLHYVSEPVVTVAIEPKNPRDLPKLIEALRT
LSIEDPNLKVTINQETGEYLLSGMGMLHIEIALTQLKEVYGLEVKVSPPVITYRETVRKP
GEKVEGKSPNKHNKLYITVEPLEKEVIEMIQKGEITDDQDPRERAKVLRDKVNWDADTAR
RIWAVDEENFNIFIDKTVGVQHLREVKDTILAGWRLAMKEGPLAKEPVRGVKVILWDAVI
HEDPAHRGPAQLYPAVRNAVYASMLTDSPTLLEPWQKLDIRVPNEYIGAVTGVITKHRGK
ILEVIDMGGQARIVAAVPIAESFELPMELRSVTAGRAFWGTEFYGWEPVPDQLLPELIRK
IRERKGLPPEPPKAEDFLGP
Download sequence
Identical sequences A8ACA7
453591.Igni_1383 WP_012123523.1.33635 gi|156938170|ref|YP_001435966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]