SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156938228|ref|YP_001436024.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156938228|ref|YP_001436024.1|
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000478
Family GHMP Kinase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156938228|ref|YP_001436024.1|
Sequence length 308
Comment beta-ribofuranosylaminobenzene 5'-phosphate synthase [Ignicoccus hospitalis KIN4/I]
Sequence
MRVKVSAPSRLHFALVDLSGDLGRLDGGAGVALKFPRTVVVAEENDELAYEGPRADEVVP
KLKRLGLKGKVRVIETPPPHAGFGSTTSLLLSSAKALFELNGIPVTSRELAVFMGRGGTS
GVGVAAFEGGGFIVDFGHDAELKRRPLPSGASLTTPPPYLRLEFPEEWAFVISIPHKGVY
DERREVSEFLKHTPIPPEESALTARIILMMIIPSILEKDLELFKRGINELQKVGFKRIER
ELQDEKTKEVCRTFREVAGSAGLSSMGPACFAVVHVTESRVIMEELESKISDVEVRITTA
DNVGARVF
Download sequence
Identical sequences A8ACG5
453591.Igni_1441 WP_012123581.1.33635 gi|156938228|ref|YP_001436024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]