SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937739|ref|YP_001435535.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937739|ref|YP_001435535.1|
Domain Number 1 Region: 1-165
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.24e-32
Family Adenylyltransferase 0.00000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156937739|ref|YP_001435535.1|
Sequence length 171
Comment nicotinamide-nucleotide adenylyltransferase [Ignicoccus hospitalis KIN4/I]
Sequence
MRALFPGRFQPFHKGHLAVVKWSLERVDELVIVVGSAQESHTLQNPMTAGERVLAIRRAL
EDEGIDLRKVYIIPVPDILMNSAWVAHVRTYVPPFEAVVTRNPLVKVLFEEAGYEVLEPP
PFGREKYVATNIRALMALGDPKWEEMVPRAVAEIIKELGIIRRMRELSKRD
Download sequence
Identical sequences A8AB26
WP_012123092.1.33635 453591.Igni_0948 gi|156937739|ref|YP_001435535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]