SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156938047|ref|YP_001435843.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156938047|ref|YP_001435843.1|
Domain Number 1 Region: 11-174,234-339
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.45e-35
Family tRNA pseudouridine synthase TruD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156938047|ref|YP_001435843.1|
Sequence length 345
Comment tRNA pseudouridine synthase D, TruD [Ignicoccus hospitalis KIN4/I]
Sequence
MRRPHPIDYYVGMTKYFLNLEACEGRVLRPKGFRVIELSEPSPGPSYVYLLLKEGIDTIH
ALREIRRRLGGKWYHLGLKDANGVTLQLLSSDVVSEGLQLRLRKGCLVLTPLGRGSINKA
RMWGNAFVIDLQCSKPHSLEGKVKVPGYFSYQRFGTARPVSHVVGKMILLERWEEAVEAL
LGEPTPWESEAARRVRLEYYSEGPRAYLRAPKFMDVERRVAFELLRGSSPKRALKKSGLT
ELFLHAYQSYLYNKRLSEFDDPCEGPEALPGPGAEGYEELLEEEGVTLELFKKFGLRAAP
RRPCYETYVKSFARGDGRVTLIFKLPRGYYATSLLREIVRDPFAV
Download sequence
Identical sequences A8ABY4
gi|156938047|ref|YP_001435843.1| WP_012123400.1.33635 453591.Igni_1260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]