SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156977456|ref|YP_001448362.1| from Vibrio harveyi ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156977456|ref|YP_001448362.1|
Domain Number 1 Region: 10-300
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.4e-29
Family Thioesterases 0.0000000000904
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156977456|ref|YP_001448362.1|
Sequence length 305
Comment acyl transferase [Vibrio campbellii ATCC BAA-1116]
Sequence
MSNQCKTIAHVLPVNNGQEIHVWETPPKENAPSKNSTILIASGFARRMDHFAGLAEYLSE
NGFHVFRYDSLHHVGLSSGSIDEFTMTTGKNSLCTVYHWLQTKGTQNIGLIAASLSARVA
YEVISDLELSFLITAVGVVNLRDTLEKALGFDYLSLPINELPNDLDFEGHKLGSEVFVRD
CFEHHWDTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRSGHCKLYSLLGSS
HDLGENLVVLRNFYQSVTKAAIAMDGGSLEIDVDFIEPDFEQLTIATVNERRLKAEIESR
APEMA
Download sequence
Identical sequences A7N6K1
gi|156977456|ref|YP_001448362.1| 338187.VIBHAR_06243 gi|538267200|gb|AGU98400.1| WP_012129722.1.100291 WP_012129722.1.11576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]