SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159904625|ref|YP_001548287.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159904625|ref|YP_001548287.1|
Domain Number 1 Region: 53-181
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000179
Family Ngr ectodomain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159904625|ref|YP_001548287.1|
Sequence length 203
Comment hypothetical protein MmarC6_0234 [Methanococcus maripaludis C6]
Sequence
MTDVVGTHKDNYDIFGDFEIESLSNGCNIVGYHGNSGDLIILGEYYGKPIIHIEDNVFKF
KNLTSVIIPNSVTSIGDGSFSNNKLKSVVIPNSLKIIGDGAFSNNPLKTVVISDSVTSIG
KGAFSNNQLKSVVIPNSITSIGRGTFSNNQLKSVVIPDSVKIIEDGAFSHNQLKSVVIPN
SITSIGKGAFYTTGYRAWLFQIR
Download sequence
Identical sequences A9A7D1
444158.MmarC6_0234 WP_012193039.1.31524 gi|159904625|ref|YP_001548287.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]