SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159904626|ref|YP_001548288.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159904626|ref|YP_001548288.1|
Domain Number 1 Region: 158-260
Classification Level Classification E-value
Superfamily TPR-like 0.000000000316
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Weak hits

Sequence:  gi|159904626|ref|YP_001548288.1|
Domain Number - Region: 17-98
Classification Level Classification E-value
Superfamily L domain-like 0.00133
Family Ngr ectodomain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159904626|ref|YP_001548288.1|
Sequence length 269
Comment hypothetical protein MmarC6_0235 [Methanococcus maripaludis C6]
Sequence
MTSVIIPDSVKIIEDGAFSYNKLTNLIIPDSVTTIGKGAFSYNKLSSVVIPDSVTTIGVL
AFHNNELSDIVLPESLKSIENMAFSENQLKSVVIPKSVANIEDGAFTTLPRSSENSLKFE
IKSMPYTYAEKYARVNCMPYTVITPLEELQIHESNRKNCEKYISEQFAEKTDDEIASEWY
NLARNEKDYSKKYEYYKEVLIIYLEHLNVNPSDVDVLYNTGVVYYALQEYVKCRVILSKL
LKINNTHEKALQLRLLCEQSIELFKVEHK
Download sequence
Identical sequences A9A7D2
gi|159904626|ref|YP_001548288.1| 444158.MmarC6_0235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]