SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256828940|ref|YP_003157668.1| from Desulfomicrobium baculatum DSM 4028

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256828940|ref|YP_003157668.1|
Domain Number 1 Region: 327-604
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 6.93e-64
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000571
Further Details:      
 
Domain Number 2 Region: 106-180
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000746
Family YkuI C-terminal domain-like 0.069
Further Details:      
 
Domain Number 3 Region: 582-650
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000183
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|256828940|ref|YP_003157668.1|
Domain Number - Region: 174-265
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0573
Family Sensory domain of two-component sensor kinase 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256828940|ref|YP_003157668.1|
Sequence length 650
Comment Cache sensor-containing methyl-accepting chemotaxis sensory transducer [Desulfomicrobium baculatum DSM 4028]
Sequence
MKSIPIRMKLIGGFLALLILVCTGLGFIAYDRAKSASLSQVQENIQLMAQDGARLVRSRL
DFFLMGLEGIANRDVIRSMNWDRQLLTLEREIERMKYLGMGVIDADGQAKYPDGSTADLS
DRAYFKEAMAGKSVLSNVIISRVTNSPVIILATPIRGFAGDVKAVLLARLDATMLSEITD
NIKYGDTGYSYIIDGTGVLIAHGNRQFVLDQRNFVEEGKKDPQYASLGAMFQRMMKGEIG
FDQYPFMGSDRFFGFAPIENTGWSIAVGAMQDDVLTEVYRMRWMIGLASLAFFAVGIAIA
LLISRAILLPVKNCVDLLRDISEGEGDLTKRLPVESNDEIGQLAQHFNTFVEKLQRIIAE
ISGNAQTVASSATELSAVSKQTTQSVQSLSSKTSTVATAAEEMSANITSVAAGMEETTTN
LSSVAAATEEMTSTIGEISGNTERARGTTDNAARQVDNFAGILRDLGASAQEIGKVTDTI
SAISSQTNLLALNATIEAARAGEAGRGFAVVANEIKELATKTAEATNDIRTKINGIQNAT
GSAVTDIGQIVKVIGDVNEIVTTIAAAIEEQSAVTREVATNINQATTGVQDASVRASEMS
GVSRDIAQDITAVDSITGDIRSGGEQVQASAEELSKLAEQLKGLVGQFRI
Download sequence
Identical sequences C7LRA6
gi|256828940|ref|YP_003157668.1| WP_015773350.1.63071 525897.Dbac_1148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]