SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282162857|ref|YP_003355242.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282162857|ref|YP_003355242.1|
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily Cyclophilin-like 5.84e-54
Family Cyclophilin (peptidylprolyl isomerase) 0.000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|282162857|ref|YP_003355242.1|
Sequence length 145
Comment peptidyl-prolyl cis-trans isomerase [Methanocella paludicola SANAE]
Sequence
MKKAIIETDKGNIEIVLFDKDAPNTVKNFEKLANSGFYNGLKFHRVIPGFVIQGGDPKGD
GTGGPGYTIKCECYQPNAHKHTKGALSMAHAGKDTGGSQFFITHAPQPHLDGKHTVFGQV
EKGMDIVLKIKQGDKMKSVKVIEAP
Download sequence
Identical sequences D1YUY7
304371.MCP_0187 gi|282162857|ref|YP_003355242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]