SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282163182|ref|YP_003355567.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282163182|ref|YP_003355567.1|
Domain Number 1 Region: 189-442
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.07e-121
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000946
Further Details:      
 
Domain Number 2 Region: 2-188
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.83e-78
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|282163182|ref|YP_003355567.1|
Sequence length 443
Comment methyl-coenzyme M reductase beta subunit [Methanocella paludicola SANAE]
Sequence
MPKFKDKIDLYDDKGKLLEKDVPLEAISPVINPAIRKIVNLTKRTVAVSLEGIESALKTG
KVGGKGRQVLGRSLDLSIVKDADKIAKVVADTVRINKSDDTAVKVIGGGKSLLVQVPTQR
VEAGAEFVASLSCTASAVTEAIIDMYKVDMFDGPFVKNAVWGMYPQTMDLVGGNVKMILE
IPQKDEGVGYALRNILTNHCVVIAKRNTMNVAALSSIFEQAGVCEMGDAVGPWERYQLLG
FAYQGLNANNLVYSTVKENGKNGTIGSVVASVIGKAIEDKVIKVEKTLPSGYKLYTTDDI
PLWNAYTAAATMAATMVNCGALRGAQAVSSTLLYTNDLIERETGLPGCDFGKVEGTAVGF
SFFSHSIYGGGGPGVFNGNHVVTRHSKGFAVPCVSAACSLDAGTQMFSPEATSGILGIFG
EIAEFREPLSHVAKGAAEVKGKV
Download sequence
Identical sequences D1YVW2
gi|282163182|ref|YP_003355567.1| 304371.MCP_0512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]