SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282163186|ref|YP_003355571.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282163186|ref|YP_003355571.1|
Domain Number 1 Region: 277-556
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.78e-146
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000000812
Further Details:      
 
Domain Number 2 Region: 4-276
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.04e-140
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|282163186|ref|YP_003355571.1|
Sequence length 557
Comment methyl-coenzyme M reductase alpha subunit [Methanocella paludicola SANAE]
Sequence
MSVKETQKRFIKAMKKKFAGEDPTSTTTVYKYEGYTQSKRKVEFKKAGDAIAKKRGISAY
NPMVHMGGIPLGQRQLTPYVVSGTDVVVEGDDLHFVNNAAMQQFWDEIRRTVIVGLDTAH
ATLEKRLGKTVTPETISNYLAILNHAMPGAAVVQEHMVETNPALTDDCFVKVFTGDDELA
DSIDKQYVLDINKAFPKDQAAALKKAVGKSLYQAVHIPTTVVRTCDGGTTSRWSAMQIGM
SFIDAYKMCAGEAAVADLAFAAKHASLVEMADILPARRARGPNEPGGLSFGFLADIVQTN
RKYPDDPCKSSLEVVAAGCMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDDFTYYGYDY
AKGKYKIGQTKPTMDIVNDLSTEVTLYGIEQYEKYPTTLEDHFGGSQRATVLSAAAGVTT
AIATGNSNAGLSGWYMSMYLHKEAWGRLGFFGYDLQDQCGATNVFSCRSDEGAIDELRGP
NYPNYAMNVGHQGGYAGIAGAAHFGRGDAWTASPLIKICFADKSLAFDFTEPRKEFARGA
IREFMPAGERTLVIPAK
Download sequence
Identical sequences D1YVW6
304371.MCP_0516 gi|282163186|ref|YP_003355571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]