SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282163660|ref|YP_003356045.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282163660|ref|YP_003356045.1|
Domain Number 1 Region: 88-248
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.32e-33
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0034
Further Details:      
 
Domain Number 2 Region: 2-92
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.23e-20
Family Ferredoxin reductase FAD-binding domain-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|282163660|ref|YP_003356045.1|
Sequence length 288
Comment putative oxidoreductase [Methanocella paludicola SANAE]
Sequence
MHRIVRKIELASGTTLFEVEAPDVARKARPGQFVIVRIDDAGERIPLTIADYDGGKGTVT
LVALSIGKTTTMLSRLEEGDSILDLAGPLGNPAEMIENGTVVCIGGGLGIAPIYPIAREL
KAKGNKVISIIGARTASLLFWEEKMRAVSDELHIVTDDGTAGRKGFAVHPLMDLINAGVK
LDRVMIIGSAIMMKVTAEATRPHGVKTIVSLNPIMVDGTGMCGSCRVTVGGKVKFACVDG
PEFDGHQVDFDELMARLRMYMDQEKLALEKYTHQIEGVPACLSSHPQK
Download sequence
Identical sequences D1YX90
gi|282163660|ref|YP_003356045.1| 304371.MCP_0990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]