SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282164405|ref|YP_003356790.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|282164405|ref|YP_003356790.1|
Domain Number - Region: 93-126
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00306
Family Rubredoxin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|282164405|ref|YP_003356790.1|
Sequence length 137
Comment hypothetical protein MCP_1735 [Methanocella paludicola SANAE]
Sequence
MATKYKLKTDPVGMVGRDCPRQSCKAYFKVREADVYGDVELTCPNCGSQANVKKYTTEEQ
IKYINSLIFHHNECPVDFNYSKTTPCYDYVERPAHCTFSCDSCKNKFGYDAKPNYCPYCG
ATHEHLHVDGTCELKEP
Download sequence
Identical sequences D1YZD5
gi|282164405|ref|YP_003356790.1| 304371.MCP_1735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]