SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282164730|ref|YP_003357115.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282164730|ref|YP_003357115.1|
Domain Number 1 Region: 17-234
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00000000000000989
Family Terpene synthases 0.032
Further Details:      
 
Domain Number 2 Region: 181-332
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0000706
Family Terpene synthases 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|282164730|ref|YP_003357115.1|
Sequence length 334
Comment hypothetical protein MCP_2060 [Methanocella paludicola SANAE]
Sequence
MGDWTAALNGYPIDWLLEEDNPSVRYFTLTGLLQKPVNDPEVVSAKRSLMMNGLIPSILA
KQEAAGYWGMPEDFYVRSKYKGTVWTLILLAHLGADGSDPRIKKACEYILDYSQDRESGG
FSYRRFRGAAYRDGLLPCLTGNMAWCLIRFGYLDDPRVQRSIEWITQYQRFDDGDGSPSG
WPYGKHEACWGRHTCHYGVVKALKALAEIPPRKRSKPVKATIEAGAEYLLKHRIYKSSHD
PEKVTMPGWLKFSFPRMWSTDALEVLGILARLGYRDERMQDAIDAVLEKQDAQGRWLNED
RYGSRYIMRVDRTGRPSRWVTYEALHTLKLLKFP
Download sequence
Identical sequences D1Z0B0
gi|282164730|ref|YP_003357115.1| 304371.MCP_2060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]