SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282165114|ref|YP_003357499.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282165114|ref|YP_003357499.1|
Domain Number 1 Region: 41-209
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.3e-48
Family Tpt1/KptA 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|282165114|ref|YP_003357499.1|
Sequence length 211
Comment probable RNA 2'-phosphotransferase [Methanocella paludicola SANAE]
Sequence
MQAREQISEIRQCPRHGYFRGSQCNCGSPGRFILSGFKAEKLGRIISGALRHFPAELGLK
LDEHGWANIDDLERAIAAKYSWARREHIEAMLDTDEKGRYEHDGERVRARYGHSIKVDLD
YPEADYDLLYYGTSEEEADRILEIGLKPVNQHHVHLSKSIEEAVKVACIRTENPVIISID
ARKAKENGIRILDAGPVCLSGPIPPEYLKIE
Download sequence
Identical sequences D1Z1E4
304371.MCP_2444 gi|282165114|ref|YP_003357499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]