SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282165421|ref|YP_003357806.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282165421|ref|YP_003357806.1|
Domain Number 1 Region: 5-249
Classification Level Classification E-value
Superfamily CorA soluble domain-like 4.18e-58
Family CorA soluble domain-like 0.00000984
Further Details:      
 
Domain Number 2 Region: 251-312
Classification Level Classification E-value
Superfamily Magnesium transport protein CorA, transmembrane region 1.44e-21
Family Magnesium transport protein CorA, transmembrane region 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|282165421|ref|YP_003357806.1|
Sequence length 315
Comment putative magnesium and cobalt transport protein CorA [Methanocella paludicola SANAE]
Sequence
MSLRVVSYTEKELREITLEEAVTCSGCNKWVSMLSPSPQEFKAVADAFELHPLVVEDMAN
DKELPKVNEYAHYTFLILDVPEHDDEFAISKLYIVIGRDFLISLTGNWDVLRAVDATLNS
KDDPIQKHGIDYLAYALIDRSVDRFYPILDDLEDLVSDVEERVMGKPAKEIIGTISEVRR
FLLKIRKAAWLDREVLSALERQGSPYFTSETALYLRDVYDHIVQVMDLIETYRDILGAAR
DTYMSSVSNALNETMKQLTIIATLMLPLTFISSIYGMNFKNMPELYWEYGYYAVLVIMFL
LASGMIIYFRKREWL
Download sequence
Identical sequences D1Z2A1
gi|282165421|ref|YP_003357806.1| 304371.MCP_2751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]