SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282163185|ref|YP_003355570.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282163185|ref|YP_003355570.1|
Domain Number 1 Region: 6-251
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.24e-120
Family Methyl-coenzyme M reductase gamma chain 0.0000000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|282163185|ref|YP_003355570.1|
Sequence length 252
Comment methyl-coenzyme M reductase gamma subunit [Methanocella paludicola SANAE]
Sequence
MAYKAQYYPGKTSVAQNRKKFMDPSYKLEKIRSLSDDDVVIMLGHRAPGSAYKTIHPPLK
EGGEPDDPIRKIVEPTAGAAAGDRIRYCQFTDSMFYAPAVPYLRSWMAATRYRGVDPGTL
SGRQIVEARERDVEKITKELMETEVYDAARSGLRGCTVHGHSLRLNENGMMFDMLQRVVL
DKNGNVYAVKDQVGDPLDRKVNLGKPMSDAELKKRTTIYFIGGVPFRSDAEVVGWVQRIH
NERTKCGFAPKL
Download sequence
Identical sequences D1YVW5
304371.MCP_0515 gi|282163185|ref|YP_003355570.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]