SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282164647|ref|YP_003357032.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282164647|ref|YP_003357032.1|
Domain Number 1 Region: 209-312
Classification Level Classification E-value
Superfamily SIS domain 0.0000000000000154
Family mono-SIS domain 0.0016
Further Details:      
 
Domain Number 2 Region: 29-137
Classification Level Classification E-value
Superfamily SIS domain 0.00000000182
Family mono-SIS domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|282164647|ref|YP_003357032.1|
Sequence length 387
Comment putative 3-hexulose-6-phosphate isomerase [Methanocella paludicola SANAE]
Sequence
MSSTDLFYDSVKIQQQFIGQLEEVKKGKILEFINLLAGFILDDTKHTKVIYGIAEGRSAL
ALYDFLQQSSMYENIYPVTLDDPIRRYIDPGKENLVIAATGSGETKGVLRYLEDAFTQKV
PVVLITANVNSRAYNMVSSYENGYIFDIEPLKGISNKNLAALGSEFELKLSVLLNAVIPE
LYHHDPGKDADKYYLTLEHVMKNAGLLLNIDSAHLDEWSDKVLNRRGNYVVDGVSRSGFV
ANAFGMRLTHLGRNVFMRDGPTTPAFLRGDAYLPITGSGNTREIIEGAIKAKLHGADVFP
ITVNYNSKLTSLMESWGYSKNIMFVPVEQTDINMYREKEASKIVATKSVQTRPSISELNS
YIFTNAFIALGIDMLGVSEKYLAQKHV
Download sequence
Identical sequences D1Z027
gi|282164647|ref|YP_003357032.1| 304371.MCP_1977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]