SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294055461|ref|YP_003549119.1| from Coraliomargarita akajimensis DSM 45221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294055461|ref|YP_003549119.1|
Domain Number 1 Region: 460-606
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-35
Family Histidine kinase 0.0027
Further Details:      
 
Domain Number 2 Region: 7-160
Classification Level Classification E-value
Superfamily CheY-like 9.96e-26
Family CheY-related 0.0049
Further Details:      
 
Domain Number 3 Region: 637-759
Classification Level Classification E-value
Superfamily CheY-like 1.99e-20
Family CheY-related 0.0095
Further Details:      
 
Domain Number 4 Region: 236-369
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.43e-18
Family Heme-binding PAS domain 0.039
Further Details:      
 
Domain Number 5 Region: 136-237
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000761
Family Heme-binding PAS domain 0.032
Further Details:      
 
Domain Number 6 Region: 381-450
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000667
Family Homodimeric domain of signal transducing histidine kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294055461|ref|YP_003549119.1|
Sequence length 760
Comment PAS/PAC sensor hybrid histidine kinase [Coraliomargarita akajimensis DSM 45221]
Sequence
MEKDFLDVLLFEDNTVDAKLVTRYLEQSRMGCDVVRVASLGDGVKLLRKAAFDVVLIDLS
LPDSEGVETVRRIASLTSEEVIIVLTGTDDEALALQALKAGAQDYLFKDQLSSEALSRSI
RYSMERANLLTRVELHNKETQMREDLLRRIFDANTDAMLILTDECEIRFLNPAAAELLDS
TEESLMGEIFPFEVRGDEKAELEIPTGRGATRFVELRAVDLVWNGENSMLVVLHDITDFR
TAEVALSREKHRLDVTIDGIADAVVATDSEGMVERLNAEASRLLGLAVGDVSGVNIREVL
KLVDPVKRSPVKRVRHLLFESGRAHSAEGLQGFPLSCADGEERLVDIRVRTVQDGDGRHG
HVIVFRDVTKLKQHEEELFMAEKMQSISQLAGGIAHDFNNMLTAVLGNISVVRMSLGSEH
EEANRLESAEKAALQARTLTQQLLSFSKGGAPVIEATTIDQLVEDCAQFLLRGSNVRCEV
EKDAELWAVDADKGQVGQVVNNLIINANQAMPDGGVIRLRLENASVRSNDITSLERGDYV
CIAVADEGTGIPAENLNRIFDPYFTTKKDGNGLGLASCYSIIRNHKGVILVESVVGEGTE
FKVYLPKSSHVSEASEAEPDLPEPAEVEMKASSGSPSGRVLVMDDMEAMMMVAGEILQLL
GYEVVLTSDGTEAIDAYKVAKESGKPFDVVVFDLTVPGGMGGEQACAILREYDPGLKAIA
SSGYSTSNIMSDWKSSNFDAVVPKPYRIKEMGEAMEQLLG
Download sequence
Identical sequences D5EKP2
gi|294055461|ref|YP_003549119.1| WP_013043671.1.49664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]