SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|260062274|ref|YP_003195354.1| from Robiginitalea biformata HTCC2501

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260062274|ref|YP_003195354.1|
Domain Number 1 Region: 312-472
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.97e-27
Family HD domain 0.045
Further Details:      
 
Domain Number 2 Region: 207-298
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000128
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|260062274|ref|YP_003195354.1|
Sequence length 522
Comment phosphodiesterase [Robiginitalea biformata HTCC2501]
Sequence
MDITTIAIALVVGLGIGFAIAKLLEKGQASKTIAAAKKESAAILKDARAEGENIKKEKIY
QAKEKFLELKAEHEKVILSKDKKITEAEKRTRDKESQVSSELARNKKLNEELEKQLEEIA
SKREFFERKQGELEKLHNSQVQQLEVISGLSAEEAKGQLLESLKETAKTDAMAYLQTTLE
ETKMTAQQEAKKIIVNTIQRIGTEEAIENCVSVFNLESDDVKGRIIGREGRNIRALEAAT
GVEIIVDDTPEAIILSCFDSVRREVARLSLHKLVTDGRIHPARIEEIVRKTEKQIEQEIV
EVGKRTVIDLGIHGLHPELIRTVGRMKYRSSYGQNLLQHSREVAKLCGVMAAELGLNPKL
AKRAGLLHDIGKVPNTETELETPHAILGMQWAEKYGEKPDVCNAIGAHHDEIEMKSLIAP
VVQVCDAISGARPGARRQVLDSYIQRLKDLEEIAFGFGGVQKAYAIQAGRELRVIVESEK
VSDEKAAQLSFEISQKIQTDMTYPGQVKVTVIRETRSVNVAK
Download sequence
Identical sequences A4CMW5
WP_015754328.1.95753 gi|260062274|ref|YP_003195354.1| 313596.RB2501_11792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]