SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|295704514|ref|YP_003597589.1| from Bacillus megaterium DSM 319

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|295704514|ref|YP_003597589.1|
Domain Number - Region: 46-83
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00314
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|295704514|ref|YP_003597589.1|
Sequence length 85
Comment hypothetical protein BMD_2392 [Bacillus megaterium DSM 319]
Sequence
MGKPHVRTVADVRVLEAEFKNKRGFKQSGRVRKEMVPDWLSQDTGEVDSQTSTPVAVAND
ECEEEKRKLEAELKALHEELKAGKE
Download sequence
Identical sequences D5DFW2
WP_013083230.1.11259 gi|295704514|ref|YP_003597589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]