SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|295702484|ref|YP_003595559.1| from Bacillus megaterium DSM 319

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295702484|ref|YP_003595559.1|
Domain Number 1 Region: 189-481
Classification Level Classification E-value
Superfamily Subtilisin-like 1.83e-72
Family Subtilases 0.00000587
Further Details:      
 
Domain Number 2 Region: 501-592
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000445
Family Collagen-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|295702484|ref|YP_003595559.1|
Sequence length 723
Comment subtilisin like serine protease [Bacillus megaterium DSM 319]
Sequence
MKKSLSALLGVSLLVFGLTLGAESSYAESSTNSNVKKATQQLNPTIQIPASKVKKKEKNL
FSGSSKKETRRGKITEADAKRGYIKDEIIVKFKTNKSLSSLGDKIKVKGLKLNKTLDKKL
GIQTLKFDTNVSTMKEILKVLNASSAVEYAEPNYIYKPAAVSEPYYQYMWGLKNTGQYID
GAAGKKGIDINAESAWVKTKGSASTTVAVIDTGVDIYHPDLKDNIWKNPGEIAGDGIDND
RNGYIDDVNGWDFYYDDDEVYYDEEYDAHGTHVAGTIGAKENSTGVIGVAPNVKIMSLKF
IGPDGGSTDGAIAAINYAKSKGVKVSNNSWGGGEYSQALYDVIKSSNSTFIAAAGNDGDN
IDSYPAYPAAYDLPNIVSVAAIDNQGNLGDFSNYGSKNVDVAAPGVSVLSTIPENSYAYG
DGTSMAAPHVTGVASLVLAANPSFSSAQLKDTLMKSTTKLSSLTGKVASGGLVNAGLAVS
ADIDGEIPGVSLNGNSISSTLNASTDKDDVYSVKLTKGEKFTVSLSGAAGTDFDLYLYNQ
NTKTVNSSDGIVAYSEKLNTSSETLTFVASADGTYYLDVYAYKGSGSYKVDVKYGAAAGV
YEDTSTNLAYTGNWSKVSNSSSSGGSYKAVNEANASMQFVFNGTEVSLNTLKDNTQGQAK
VTLDGTAYWVDLYADKPQYKATVFNKKGLKAGKHTLKVEWSGKVHPGAKKTVTKVTLDSI
TVK
Download sequence
Identical sequences D5D9E7
WP_013081456.1.11259 gi|295702484|ref|YP_003595559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]