SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289191915|ref|YP_003457856.1| from Methanocaldococcus sp. FS406-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289191915|ref|YP_003457856.1|
Domain Number 1 Region: 189-443
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 8.37e-130
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000656
Further Details:      
 
Domain Number 2 Region: 3-188
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.14e-81
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289191915|ref|YP_003457856.1|
Sequence length 447
Comment methyl-coenzyme M reductase, beta subunit [Methanocaldococcus sp. FS406-22]
Sequence
MLHYEDKIDLYDERGKLLEENVPLEAISPLKNPTIERIVNDIKRSVAINLAGIENALRTG
AVGGKACFCPGRELDLPIVENAEIIAEKIKKMVQIEEDDDTVVKLINGGKQLLLQLPSKR
LRVAADYTVSALIGGGATVQAIVDTFEVDMFDAPVVKTAVMGRYPQTVDFHGANIATLLG
PPVLLEGLGYGLRNIMANHIVAVTRKKTLNAVALASILEQTAMFETGDALGAFERLHLLG
LAFQGLNANNLTFELVKKNGKDGTVGTVVASVVERALEDGVIRPVKTLPSGFTVYEPVDW
ALWNAYAASGLVAAVIVNVGAARAAQGVASTVLYYNDILEYETGLPSVDFGRAEGTAVGF
SFFSHSIYGGGGPGTFHGNHVVTRHSKGFAIPCAAAAMCLDAGTQMFSVERTSALVGTVY
SAIDHLREPLKYVAEGAVEVKEKEKVI
Download sequence
Identical sequences D3S7W0
WP_012980031.1.35598 gi|289191915|ref|YP_003457856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]