SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289192736|ref|YP_003458677.1| from Methanocaldococcus sp. FS406-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289192736|ref|YP_003458677.1|
Domain Number 1 Region: 31-112
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0000523
Family Mitotic arrest deficient-like 1, Mad1 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289192736|ref|YP_003458677.1|
Sequence length 157
Comment Flagella accessory C family protein [Methanocaldococcus sp. FS406-22]
Sequence
METEKYDELERTVKDLMETTEGLLAKVNDIESKLPKLESSINNLRKENEMLRVELSKINE
NLQDIMALYEVVSNQINPFIGVSKITATSLEKLERLETEYKRLKKTVEELTNDLIILGSL
YLHQLDINLDEIIEEVLEEEIIKSMSGEDTHDTKDNK
Download sequence
Identical sequences D3S527
gi|289192736|ref|YP_003458677.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]