SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269124902|ref|YP_003298272.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269124902|ref|YP_003298272.1|
Domain Number 1 Region: 274-523
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000000000915
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0059
Further Details:      
 
Domain Number 2 Region: 605-719,773-876
Classification Level Classification E-value
Superfamily Sialidases 0.000000000000363
Family Sialidases (neuraminidases) 0.028
Further Details:      
 
Weak hits

Sequence:  gi|269124902|ref|YP_003298272.1|
Domain Number - Region: 146-334
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269124902|ref|YP_003298272.1|
Sequence length 964
Comment glycosyl hydrolase BNR repeat-containing protein [Thermomonospora curvata DSM 43183]
Sequence
MAQAGTGDDNADGRVPDGPPPAPWGSSAQDAGQQDPAGPASQEPPGFPAPPPPPPFAPPG
PGLPPPPQWGRPADDPAAALPPAPWAAPMPELPGEALPAAGDPEATSVDPRPAGDPAAGP
PAALGDPATSPPPMGFPVPPPPVGTPPMPPPGAPGAVPPPPPFAAAPPAPPLGGPGAPPA
AEPEAGRFRPRPPQQPDEPWRLPAPRRQGPRLPRKAVLIGAAGLAAAAVIAAGAVVLWPE
GEQRPAAPAAAAHLASDAFATDPAVRSDGRDQQLTTADAAGDTVVAAGGDGDGDGTAVRP
YFLVSTDGGRSFQRATVHDDGLGGVPRQVAGSASGWAALGEAPDGSALAWTSRDGRQWTA
HALGEESFKDGDRVLSLTAHPSGFLAVGTTAAKGDLRDGSPLAWVSSDGRSWERLDAGDL
KLTKGKETLSLLEATTHGSTVMVKGRWAKSEKGAPRNRVWLSGDGGRTWEETKPPSPKGT
RGMRIGSGPSGLLAVRDVRRAKKSYATIFASADGKDWTETAEVELGKGMRLQAVAGSERG
AFVVAGAGDRVQVVRSGDGRSWQATDPFTRPARLLPGTAAAGDRLVMAGWIRSGGDLNGV
LLAQDATGRLARPELPAAPVDRTVAALTTAGNQAVAVGSTNGNAAIWSSADGRTWRRGRL
TGAGFGGPGLQRLHGVAGGSTGWVAIGSDTRPQQQPRPLVAISQNGTEWSAVGGGTFADG
KDGLRVYGVAAGRSGHVVVGEDGSSAVVWASSDLRTWQRGTGVKGALKGSKGTNRWMQAV
AATADGYVAVGGSKKNGVHAPAVWTSPDGQEWTLRATPRLPEDSSGYLRHVAVSGATAVA
VGERRDADGTRRAFAFLSTDGGATWQESPLPEITGADAVRGVTAAGAAFAVFGEIRQSGS
ADVAVWTSRDGRSWQAAHPRGTALSGAGDQRLTGLVAFRGELLGVGESTERQSAEPVLWH
RPPL
Download sequence
Identical sequences D1A4J9
471852.Tcur_0639 WP_012851018.1.83154 gi|269124902|ref|YP_003298272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]