SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269125808|ref|YP_003299178.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269125808|ref|YP_003299178.1|
Domain Number 1 Region: 27-107
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000354
Family Tetracyclin repressor-like, N-terminal domain 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|269125808|ref|YP_003299178.1|
Domain Number - Region: 129-219
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00178
Family Tetracyclin repressor-like, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269125808|ref|YP_003299178.1|
Sequence length 228
Comment TetR family transcriptional regulator [Thermomonospora curvata DSM 43183]
Sequence
MLVCCTPTVEGVSVNGRRRYHRRHTSRRTQEERRSATQARLLDATAEALADLGWAGLSTT
EVSRRAGVSRGAQQHHYPTKMSLVAAALEHLLSRLRAEYEQAYAELPEEQRNIEGALDLF
WEMLRQPPAIALLELALAGRTDESLRDLSADLHERVIVIIKEVFHELFPESLPPEIVDTT
IRGLFALLVGLSIQNSLDNDVHGHQAAVLALVKDIAHMLIPDDKETRS
Download sequence
Identical sequences D1ABA4
471852.Tcur_1564 gi|269125808|ref|YP_003299178.1| WP_012851924.1.83154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]