SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269126755|ref|YP_003300125.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269126755|ref|YP_003300125.1|
Domain Number 1 Region: 1-410
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.13e-85
Family Gtf glycosyltransferase 0.00000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269126755|ref|YP_003300125.1|
Sequence length 412
Comment glycosyl transferase family 28 [Thermomonospora curvata DSM 43183]
Sequence
MRVVLSTWGGRGDVEPMAALAVRLRERGVQVRLCAPPDEDIARRLAAVGVPLVPYGPSAR
ASASKALPPTESARPPAGEVVARVSAEIAASQRRVLPEAAEGCDALVATGVPAALGGARS
VAEKLGVPWVHVTFQQLTLPSPHRAPLAYPGQSYPPGITDVPTLWKLHDRYLNELFGEAI
NATRAALGLPPAEDVTSFLFGGRNWLASDPVLDPWQGSAEVDVVQTGAWFVPDDRPLPDD
LRAFLDAGEPPVYVGFGSMPMKAAADLPRAVVEAVRAHGRRMVLLRGWAGLSAVDDRDDC
FVVGEVNHQALFGRVAAVVHHGGAGTTATAARAGRPQVLVPQGADQPYWAGRVAELGIGA
AHDGPVPTARSLASALETALAPETAERAAALAGRVRTDGAATAADLVVEQLG
Download sequence
Identical sequences D1A4R8
WP_012852871.1.83154 gi|269126755|ref|YP_003300125.1| 471852.Tcur_2526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]