SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269126990|ref|YP_003300360.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269126990|ref|YP_003300360.1|
Domain Number 1 Region: 1-379
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 5.71e-62
Family Gtf glycosyltransferase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269126990|ref|YP_003300360.1|
Sequence length 380
Comment hypothetical protein Tcur_2776 [Thermomonospora curvata DSM 43183]
Sequence
MRFLFMTGGGSAPIHASVPLAWAARTAGHEVIMAAPQENLDLIVGLGLPAAPVTRLGMGD
AMLKDREGNWLPMPTGEDDEMDFAGRGFARLAAASYEGAAKLVEAWRPDVVIGGEYTLVA
PLIAHRFGLPLVSHTWAIYDRTDVDWQGATDELRPELSRFGLEQVPAWDLFVDITPPSVR
PAHAEPAQPMRWTPGNSQVPLEPWMYTKGDRPRVVLTSGSRSMFVPNLGVDFFRPLLQTP
LLSSGEVEVIAATSEAVAAHLREEFPGLKAGYVPLDVVAPTADAVVHHGGGVTVMTLLNA
GTPQVVLPEIKYSAIPLRPVDEFGASITLPSHREPPEEVAAAISKILENPSYAGRAAKLA
EEIAGMPAPAEVVKKIEALV
Download sequence
Identical sequences D1A6R8
471852.Tcur_2776 gi|269126990|ref|YP_003300360.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]