SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157828218|ref|YP_001494460.1| from Rickettsia rickettsii str. 'Sheila Smith'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157828218|ref|YP_001494460.1|
Domain Number 1 Region: 137-279
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.86e-43
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.00022
Further Details:      
 
Domain Number 2 Region: 4-129
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.05e-39
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157828218|ref|YP_001494460.1|
Sequence length 291
Comment UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Rickettsia rickettsii str. 'Sheila Smith']
Sequence
MPKMQQSTLLKPVSCYGIGVHSGKRTQLTIEPAKENTGIIFIRTDISSENNYIEASYFNV
SDTLLSTTISNDHKVQISTIEHLMAALWGCRIDNAIIKIDGPEVPIMDGSSKPFVFMIEC
AGKKLQNAPKKYLKILKDIKVVHKDCELYCTPSDHMTVDLTIDFSSKAIGRQNLSFRDQE
SFTKNIADARTFGFIRDVDYLKSKGLAQGASFENAIGIDEQDKILNPNGLRYEDEFVRHK
LLDLFGDLYTNGTSIVSAIKGYKTSHALNNELLHRIFSDTTSYKFVTSSEL
Download sequence
Identical sequences A0A0H3AXJ3
gi|157828218|ref|YP_001494460.1| 392021.A1G_01940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]