SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157828505|ref|YP_001494747.1| from Rickettsia rickettsii str. 'Sheila Smith'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157828505|ref|YP_001494747.1|
Domain Number 1 Region: 587-762
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-55
Family ATP-dependent protease Lon (La), catalytic domain 0.00000197
Further Details:      
 
Domain Number 2 Region: 305-578
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.59e-47
Family Extended AAA-ATPase domain 0.00033
Further Details:      
 
Domain Number 3 Region: 3-196
Classification Level Classification E-value
Superfamily PUA domain-like 2.36e-21
Family LON domain-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157828505|ref|YP_001494747.1|
Sequence length 770
Comment ATP-dependent protease La [Rickettsia rickettsii str. 'Sheila Smith']
Sequence
MALRDMVVFPGVIAPIFVGRPKSLQALSHTTISEEDNSKYILVTLQKKFDQENPSTHELY
NTAILAKIIQIVKLPNNTAKILIEAVARVKLSNIKGDEAFEANYEIIPDEEIFDVNNMRS
LVDNAVQLFSKYAINDKKVNAEIIETINKAISNSTNFIDIINILASHLITSLEAKQHLLE
ETSPFKRITTVISTLTSNIVNSETEQALQQRVRKQIEKTQRDYYLHEQMKAIQKELDEDK
SELADIEKKIKSLKLSKEAKEKAEAELKKLRTMNQMSAESGVTRNYLETLLSLPWGKYDN
SKIDINQAEKILNRDHFGLEKVKERIIEYLAVLQRSSKIRGPILCLIGPPGVGKTSLVKS
IAEGMGRKYTKLALGGVRDEAEIRGHRKTYLGSMPGKILGQLKKVKTSNPVMLLDEIDKM
SSDFRGDPASALLEVLDPEQNSHFVDHYLEVEYDLSNVIFIATANSHDLPRALSDRMEKI
YISGYVEETKLQIARNYLVPKQFKMHKIKKDEITISEMALLDLIRYYTKESGVRALEREI
GALTRKALKQILADKSVKHIAIDSNHLEEFLGAKKYNFGLAEKEDQIGSTTGLAYTEVGG
ELLTIEALAFPGKGEIKTTGKLGDVMKESAMAAYSCFRSRATNFGLKYDNYKDFDIHIHV
PAGAIPKDGPSAGCALFTTIVSLMTKIPVHRTVAMTGEITLRGNVLPIGGLKEKLLAASR
GGIKTVLIPEENVKDLQDIPPNIKESLEIISVSNIDQVLKHALVGTPINK
Download sequence
Identical sequences A0A0H3AWG5
392021.A1G_03540 gi|157828505|ref|YP_001494747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]