SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157828824|ref|YP_001495066.1| from Rickettsia rickettsii str. 'Sheila Smith'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157828824|ref|YP_001495066.1|
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-44
Family Ribonuclease PH domain 1-like 0.00000635
Further Details:      
 
Domain Number 2 Region: 154-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.03e-22
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157828824|ref|YP_001495066.1|
Sequence length 239
Comment ribonuclease PH [Rickettsia rickettsii str. 'Sheila Smith']
Sequence
MRQSGRKSNQLRPISLELSPLINAEGSCLIKIGNTHVMCSATCETTVPPFLRGQNQGWIT
AEYGMLPGSTSQRIKREAALGQQGGRTQEIQRLIGRAMRCVIDVRKLGERQIIIDCDVIN
ADGGTRTAAITGSYVALHLAIRSLMKKRVLKVNPLISQIAAISCGIYKGEVILDLDYLED
SDADVDSNFVFAGNGNLIEVQGTAEKNPFSEEQFLAMLKLAKGGAAELFKLQNQVLLGS
Download sequence
Identical sequences A0A161QK06 A8GT33 B0BUM3 H6PUP9
gi|379712714|ref|YP_005301053.1| gi|165933550|ref|YP_001650339.1| gi|378724348|ref|YP_005289232.1| gi|379016107|ref|YP_005292342.1| 392021.A1G_05365 452659.RrIowa_1155 gi|378721648|ref|YP_005286535.1| gi|378722994|ref|YP_005287880.1| gi|379018133|ref|YP_005294368.1| WP_012151123.1.16657 WP_012151123.1.17801 WP_012151123.1.31136 WP_012151123.1.3339 WP_012151123.1.38731 WP_012151123.1.4490 WP_012151123.1.54113 WP_012151123.1.74071 WP_012151123.1.77680 WP_012151123.1.78650 WP_012151123.1.81845 WP_012151123.1.83836 WP_012151123.1.89241 gi|157828824|ref|YP_001495066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]