SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157829199|ref|YP_001495441.1| from Rickettsia rickettsii str. 'Sheila Smith'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157829199|ref|YP_001495441.1|
Domain Number 1 Region: 420-610
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 3.01e-51
Family DNA mismatch repair protein MutL 0.0073
Further Details:      
 
Domain Number 2 Region: 1-201
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.69e-49
Family DNA gyrase/MutL, N-terminal domain 0.0000196
Further Details:      
 
Domain Number 3 Region: 189-329
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.83e-36
Family DNA gyrase/MutL, second domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157829199|ref|YP_001495441.1|
Sequence length 610
Comment DNA mismatch repair protein [Rickettsia rickettsii str. 'Sheila Smith']
Sequence
MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDASSTKIDIILERAGKNLIIISDDG
IGMTDKELEIAVERHTTSKFDESDFLNINTFGFRGEALPSIAAISKMLITSKKRDADKAF
QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVGVVKKIALAH
PKISFSLTHDGKNLLKLKGQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT
SSPTYNRASSEDQFLFINNRPVKDKLLQIALRVAYQDYLARDRYPICAIFLQINPQLVDV
NVHPAKAEVRFHDPDYVRNLLIEAIKNALTNKSHVTSTTIASDALELFKNPLVNKQSPVS
KVINVNSKSADYRPTTHSTLNTVPQNHVCQKLIDTLSHAKIEQEVENRIEHEQQIRKQYK
LGAAKAQLHTTYIISQTEDSIVITDQHAAHKRLGYEKIKHYLKTEELIKQRLLIPEIVEL
PNEKKADCLYDHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQDLADHLSDFG
KNIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTLLSGQCNHGRPTYIELK
LKDIERLFGR
Download sequence
Identical sequences A8GU58
392021.A1G_07470 WP_012151467.1.4490 WP_012151467.1.78650 gi|157829199|ref|YP_001495441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]