SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157373441|ref|YP_001472041.1| from Shewanella sediminis HAW-EB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157373441|ref|YP_001472041.1|
Domain Number 1 Region: 34-104
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000732
Family Coronavirus S2 glycoprotein 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157373441|ref|YP_001472041.1|
Sequence length 215
Comment hypothetical protein Ssed_0300 [Shewanella sediminis HAW-EB3]
Sequence
MKKYISIAIIATSLLLTGCQSAYYGAMEKVGYHKRDIMVDRVEDAKESQEDAQKQFSSAL
EEMQALLNHDGGDLEGAYNKAKDEYESAQDAADDVTKRIDKVEDVAEALFDEWQSEIGEI
SKASLRRNSEAKLRETKRSYNQLVKSMRRAESKMPPVLTAMKDNMLYLKHNLNAQAIGAI
KGEFTSLQTDISGLIKEMNKSIDESNKFIASLEGN
Download sequence
Identical sequences A8FPZ0
WP_012004439.1.70442 gi|157373441|ref|YP_001472041.1| 425104.Ssed_0300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]