SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157376643|ref|YP_001475243.1| from Shewanella sediminis HAW-EB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157376643|ref|YP_001475243.1|
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.72e-43
Family SMI1/KNR4-like 0.00000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157376643|ref|YP_001475243.1|
Sequence length 133
Comment hypothetical protein Ssed_3511 [Shewanella sediminis HAW-EB3]
Sequence
MHDIIEQLQELSETVPIPLELPTFEQIVVVEEEILMPLPSELKEYLLYASDVIYGTIEPV
TASDPYSHTYLSEVTAYAWSIGMSREYVAICQQGNSFYCIDQEGQVMLWSEDGLESETWE
SFWQWAEEVWMQS
Download sequence
Identical sequences A8FZ42
gi|157376643|ref|YP_001475243.1| 425104.Ssed_3511 WP_012143845.1.70442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]