SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161527761|ref|YP_001581587.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161527761|ref|YP_001581587.1|
Domain Number 1 Region: 120-271
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 9.56e-24
Family Aromatic dioxygenase reductase-like 0.036
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 5.26e-21
Family Ferredoxin reductase FAD-binding domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161527761|ref|YP_001581587.1|
Sequence length 281
Comment oxidoreductase FAD/NAD(P)-binding subunit [Nitrosopumilus maritimus SCM1]
Sequence
MVVDNKATITYVQLLKEDLVIIRLVPKEGPVPEYKAGQFITLGLPNPVEGGKIVRRAYSI
ASHPENREYVELVIRWVRKPLPGRLTTQLFNAKEGDEILWLKPTGRALLINEELPNGEKD
NRRIICIGGGTGLAPFVSFAQHLHDSGDKREIVVLHGASYVDELSYKDLLTELENESIRR
GKDEWNFKYRAAISRPQEWFNRSWAGQVGRVETFLRPRDNGMSPLEELIGDKITKENTIF
YVCGWQGTIDGVMDFLKPKGFVTEHDKREDGSFEVKYESYG
Download sequence
Identical sequences A9A321
gi|161527761|ref|YP_001581587.1| 436308.Nmar_0253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]